PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g40620.2.p
Common NameBRADI_2g40620, LOC100845481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 380aa    MW: 41975.1 Da    PI: 6.9917
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g40620.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.8e-1681128148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Bradi2g40620.2.p  81 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 128
                       788*******************************************97 PP

2Myb_DNA-binding50.26e-16134177146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E++l+v ++k lG++ W+ Ia+ ++ gRt++++k++w++
  Bradi2g40620.2.p 134 RGSFSQDEEDLIVSLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 177
                       899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-2473131IPR009057Homeodomain-like
PROSITE profilePS5129418.36776128IPR017930Myb domain
SuperFamilySSF466891.24E-2878175IPR009057Homeodomain-like
SMARTSM007176.8E-1380130IPR001005SANT/Myb domain
PfamPF002493.2E-1481128IPR001005SANT/Myb domain
CDDcd001671.57E-1184128No hitNo description
PROSITE profilePS5129425.154129183IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-25132183IPR009057Homeodomain-like
SMARTSM007176.1E-15133181IPR001005SANT/Myb domain
PfamPF002493.7E-14134177IPR001005SANT/Myb domain
CDDcd001674.75E-11136176No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MLCLLFEITV AFISRLSPSY IVAITSRYRA RACLPACSPQ PHQATAPHSL THSRIHPRAA  60
KCGRTMGREG AACSSKPKLR RGLWSPEEDE KLYNHIIRYG VGCWSSVPKL AGLERCGKSC  120
RLRWINYLRP DLKRGSFSQD EEDLIVSLHK ILGNRWSQIA SQLPGRTDNE IKNFWNSCIK  180
KKLRQLGIDP ATHKPLNDVD DPATTTLADS CNKQQQLIPD QDDDGSPCFN GSDVDLLLAA  240
APHSPVCSFD PLSVTNVPAT MHSSGFRSDG SLCEYGNSAY TTGGDSSSNS NSAWSNVVEP  300
LPHMDIFIRD SEPYNHPFDP AKFISSWNHQ QPHQQQHPAD QDVGGGSASF PIRSLSRDVL  360
PESCFQLARG ALEDEFDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31771833108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0925931e-156FP092593.1 Phyllostachys edulis cDNA clone: bphylf046j05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566757.20.0PREDICTED: myb-related protein Hv33-like
TrEMBLA0A0Q3J6J90.0A0A0Q3J6J9_BRADI; Uncharacterized protein
STRINGBRADI2G40620.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.16e-74myb domain protein 86